General Information

  • ID:  hor006642
  • Uniprot ID:  P52212
  • Protein name:  Parathyroid hormone
  • Gene name:  PTH
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031856 parathyroid hormone receptor binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0007267 cell-cell signaling; GO:0045725 positive regulation of glycogen biosynthetic process; GO:0046326 positive regulation of glucose import
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
  • Length:  84(32-115)
  • Propeptide:  MMSAKDMVKVMIVMFAICFLAKSDGKPVKKRSVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
  • Signal peptide:  MMSAKDMVKVMIVMFAICFLAKSDG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:  Q9TU31
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P52212-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006642_AF2.pdbhor006642_ESM.pdb

Physical Information

Mass: 1095141 Formula: C414H672N122O128S2
Absent amino acids: C Common amino acids: KLSV
pI: 9.08 Basic residues: 17
Polar residues: 18 Hydrophobic residues: 28
Hydrophobicity: -64.05 Boman Index: -18833
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85.83
Instability Index: 3995.36 Extinction Coefficient cystines: 6990
Absorbance 280nm: 84.22

Literature

  • PubMed ID:  7642102
  • Title:  Sequences of the cDNAs encoding canine parathyroid hormone-related protein and parathyroid hormone.